Last Verified: April 2026. Providing deep technical insights.
IP: Hidden
Bonus: Includes a Free Domain Name for the 1st year.
The ToolXray crawler successfully evaluated the domain digitalmarketingagencyreviews.co.uk. Based on the technical data, the website is developed on the WordPress framework and scored 60%. Looking at the performance, the TTFB (Time to First Byte) is clocked at 1.44 seconds, which plays a crucial role in its Google Core Web Vitals. To improve organic rankings, we highly recommend fix the structural errors highlighted in this report.
Meta Title
Digital Marketing Agency Reviews - DMAR
Meta Description
The following scripts, frameworks, and plugins were automatically detected during the crawl of digitalmarketingagencyreviews.co.uk:
💡 Suggestion: Your server is taking too long.
🛠️ Solution: Install a caching plugin.
💡 Suggestion: Search engines cannot 'see' images.
🛠️ Solution: Add descriptive alternate text.
💡 Suggestion: Every page should have exactly ONE H1 tag.
🛠️ Solution: Ensure only main title is H1.
💡 Suggestion: A meta description acts as your ad copy.
🛠️ Solution: Write a compelling description.
Title
Very important
The length of the page title is ok.
Meta description
Very important
Meta description is missing.
Canonical link
Important
Valid canonical link specified.
Language
Low importance
Language detected in HTML: EN-US
Content
Very important
Word count is 549.
Mobile optimization
Low importance
Viewport meta tag provided.
HTTPS
Low importance
Uses HTTPS.
H1 heading
Very important
Page has 2 H1 tags.
Internal links
Important
Internal links: 38.
Found 14 trivial links.
Performance
Low importance
Page response time is 1.44 seconds.
| Keyword | Density |
|---|---|
| Agencies | 2.73% |
| 2% | |
| Digital | 1.64% |
| Marketing | 1.46% |
| Lorem | 1.28% |
| Ipsum | 1.28% |
| Find | 1.09% |
| Please | 1.09% |
Everything you need to know about the technology stack, hosting, and SEO performance of digitalmarketingagencyreviews.co.uk.
Based on our latest theme detector scan, digitalmarketingagencyreviews.co.uk is utilizing dwt-listing for its frontend design and user interface. If it is a highly customized site, the exact parent theme might be hidden behind a child theme.
Our server infrastructure analysis reveals that digitalmarketingagencyreviews.co.uk is currently hosted on Secure Cloud Hosting. Choosing a robust hosting provider is critical for handling high traffic and ensuring fast page load speeds.
According to the detected source code footprint, this website is powered by the WordPress content management system. This platform provides the necessary backend architecture to publish and manage their content efficiently.
Performance metrics indicate that the Time to First Byte (TTFB) for this domain is approximately 1.44 seconds. A lower TTFB generally translates to better Core Web Vitals and higher organic search rankings.
The website leverages a variety of tools to function seamlessly. We detected 3 active plugins/scripts running on the frontend. You can review the complete list in the "Detected Technology Stack" section above.
ToolXray’s automated crawler assigned an overall SEO health score of 60/100 to digitalmarketingagencyreviews.co.uk. This score is calculated based on meta data optimization, page structure, internal link architecture, and server response times.
You can easily run a comprehensive, real-time analysis for your own website. Simply navigate to the ToolXray SEO Audit Tool, enter your URL, and get a detailed breakdown of your technical stack and SEO issues within seconds.
Don't just look at one site in isolation. Compare digitalmarketingagencyreviews.co.uk head-to-head against its top competitors to uncover their ultimate tech stack and SEO strategies.
Writing an article about digitalmarketingagencyreviews.co.uk? Embed this real-time SEO & Tech stack report directly on your blog!
Explore the technology stack and SEO configurations of other popular websites in our database.